PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG016269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 431aa    MW: 47828.2 Da    PI: 7.477
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG016269.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R +k+c++rw +yl
      CCG016269.1 14 KGLWSPEEDEKLLNYITKHGLGCWSSVPKLAGLQRGGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-25672IPR009057Homeodomain-like
PROSITE profilePS5129423.464965IPR017930Myb domain
SMARTSM007174.8E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-141461IPR001005SANT/Myb domain
SuperFamilySSF466896.5E-241498IPR009057Homeodomain-like
CDDcd001675.06E-111761No hitNo description
PROSITE profilePS500906.2026897IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.4E-1173114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGLGCWSSV PKLAGLQRGG KSCRLRWINY  60
LRPDLKRGAF SQQWSQIAAQ LPGRTDNEIK NLWNSCIKKK LRQRGIDPNT HKSLSEAEDG  120
KEKQQLTADK SNEKVSIVSN ELNLIEAATS KPPAVSSRSS NVITTNNNKD RSGSSNLTNI  180
PPTQEFFLDR FGTSLESSTT ASCMPSDLMD YFPFQKLDYK PIIDLSMNPN TTLCFNPNSS  240
SSEMISHEFN SSMTPPTILP SKSTSMFQTP ICVKPSVSLP SDHNPSVGSC DVNGVQNWEA  300
SSFGNNGSGS NGSSSSIELQ SNTNFFESSA FSWGFADCGK SSDEAHLRSL AKETVEDIKW  360
SEYLSTPFFL GSTIQNQTSQ HVYSEVKPET HFMAQGSSTS WLHNQHQQAS QPADIYTKDL  420
QRLAVAFDQS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-18121015108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8017490.0JQ801749.1 Populus tomentosa putative transcription factor (MYB216) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023897.10.0PREDICTED: LOW QUALITY PROTEIN: myb-related protein 315
TrEMBLB9I6B70.0B9I6B7_POPTR; Uncharacterized protein
STRINGPOPTR_0013s00290.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-112myb domain protein 61